PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0173s0240.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family WRKY
Protein Properties Length: 158aa    MW: 17831.1 Da    PI: 9.862
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0173s0240.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.79.8e-3380138159
                             ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                    WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                             ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  SapurV1A.0173s0240.1.p  80 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCSVKKQVQRLTNDEGVVVTTYEGMHSHQ 138
                             59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.5E-3465138IPR003657WRKY domain
SuperFamilySSF1182901.09E-2972139IPR003657WRKY domain
PROSITE profilePS5081129.65475140IPR003657WRKY domain
SMARTSM007745.0E-3880139IPR003657WRKY domain
PfamPF031061.8E-2681138IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSLNMITSYA STDFESTKGS GLLGLMQEMQ APASLDFDSI SQNGGFAGSE SEGKLGKRKG  60
EKKIRKPKYA FQTRSRVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CSVKKQVQRL  120
TNDEGVVVTT YEGMHSHQIE KSPDNFEHIL SQMQIFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A7e-2970139776Probable WRKY transcription factor 4
1wj2_A7e-2970139776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3774381e-166GQ377438.1 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304741.21e-105hypothetical protein POPTR_0003s16750g
SwissprotQ9FYA25e-54WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GVW01e-105B9GVW0_POPTR; Uncharacterized protein
STRINGPOPTR_0003s16750.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-54WRKY DNA-binding protein 75